Anas platyrhynchos (mallard): 113845111 Help Entry 113845111         CDS       T02816                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism apla  Anas platyrhynchos (mallard) Pathway apla04810   Regulation of actin cytoskeleton apla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apla00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     113845111 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113845111 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind LXG Motif Other DBs NCBI-GeneID:  113845111 NCBI-ProteinID:  XP_027323796 LinkDB All DBs Position 13:15946515..15947623 Genome browser AA seq 75 aa AA seqDB search MSVQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcggtgcaggaggacccggtgcagcgggagatccaccaggactgggccaaccgcgag tacatcgaggtgatcaccagctccatcaagaagatcgccgacttcctcaactccttcgac atgtcgtgccgctcccgcctggccaccctcaacgagaagctgacggcgctggagcgcagg atcgagtacatcgaggccagggtcaccaagggcgagacgctgacatag

DBGET integrated database retrieval system