Anas platyrhynchos (mallard): 119716547 Help Entry 119716547         CDS       T02816                                  Symbol MTLN Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism apla  Anas platyrhynchos (mallard) Brite KEGG Orthology (KO) [BR:apla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:apla03029]     119716547 (MTLN) Mitochondrial biogenesis [BR:apla03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     119716547 (MTLN) SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom Motif Other DBs NCBI-GeneID:  119716547 NCBI-ProteinID:  XP_038033399 LinkDB All DBs Position 3 Genome browser AA seq 58 aa AA seqDB search MGLEALRPRVVRWALLAAFAAGVLVGWQAGRARRRFLRWRQQRLQRRLDAAREKLEAA NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atggggctggaggcgctgcggccgcgggtggtgcgctgggcgctgctggccgccttcgcg gcgggcgtgctggtgggctggcaggcgggccgggcacggcgccgcttcctccgctggcgc cagcagcgcctccagcgccgcctcgacgccgcccgggagaagctggaggcggcctga

DBGET integrated database retrieval system