Agrilus planipennis (emerald ash borer): 108733720 Help Entry 108733720         CDS       T07419                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism apln  Agrilus planipennis (emerald ash borer) Pathway apln04144   Endocytosis apln04517   IgSF CAM signaling apln04518   Integrin signaling apln05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:apln00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     108733720    04518 Integrin signaling     108733720  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108733720  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108733720  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apln04131]     108733720    03036 Chromosome and associated proteins [BR:apln03036]     108733720   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apln04147]     108733720    04031 GTP-binding proteins [BR:apln04031]     108733720 Membrane trafficking [BR:apln04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     108733720  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     108733720   Macropinocytosis    Ras GTPases     108733720 Chromosome and associated proteins [BR:apln03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     108733720 Exosome [BR:apln04147]  Exosomal proteins   Exosomal proteins of microglial cells    108733720   Exosomal proteins of breast milk    108733720 GTP-binding proteins [BR:apln04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     108733720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sp-DndD Motif Other DBs NCBI-GeneID:  108733720 NCBI-ProteinID:  XP_018320508 UniProt:  A0A1W4W8W6 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQVDLR DDNSTIEKLAKNKQKPISVEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPVKRRKCAIL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactattaagtgtgtagttgtcggtgacggggcagttggtaaaacatgtttgctt atcagctacaccacaaacaaatttccatcagagtatgtgcctacagtttttgataactat gcagtcactgttatgattggaggggaaccttacacattagggttatttgatactgcaggc caagaagattatgacagactgagaccgctaagttatccacagacagatgtattccttgtg tgtttttctgtagttagtccatcatcatttgaaaatgtgaaagaaaaatgggtcccagaa ataacacatcactgtcaaaagacaccctttttacttgtgggtactcaagttgacctcagg gacgacaactcaacaatagagaaattggcaaaaaacaaacagaaaccaatttctgtagaa caaggtgaaaaactagcaaaagaattgaaggctgtcaaatatgtggaatgttctgctcta acacaaaaggggttgaaaaacgtgttcgacgaggcaattctagcagctctggaaccccca gaaccggtaaaacgcagaaagtgtgctatcctgtaa

DBGET integrated database retrieval system