KEGG   Agrilus planipennis (emerald ash borer): 108739855
Entry
108739855         CDS       T07419                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
apln  Agrilus planipennis (emerald ash borer)
Pathway
apln00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:apln00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    108739855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:apln00199]
    108739855
Enzymes [BR:apln01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     108739855
Cytochrome P450 [BR:apln00199]
 Cytochrome P450, animal type
  CYP306 family
   108739855
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 108739855
NCBI-ProteinID: XP_025833776
UniProt: A0A7F5RCS7
LinkDB
Position
Unknown
AA seq 498 aa
MYIFIAVAIIIVATALWWINDQHSLPPGPWDLPLLGFLPWLDPEHPYETLTSLAKKYGTI
YTFNLGTVRTIVLSDHKIVKQAFMKDALSGRAPLYVTHGIMKGHGLICAEGELWKDQRKF
TSYCLKNFGVSKFGSKRTELESMILKHVENLIKEIISKMNINGTVTFDPFEDLRHSVGTL
VCQLVFGRSWEKDNELWKWLLFTQEEGTKLVGVSGPLNFLPFLRFLPKYKKSMDFLVVNQ
KKTHETYSRFIQEEEKVLNELIESGKSPEPTSFVQAYLLERQKDSKANVKDKFYSDVQLH
HFLADLFGAGLDTTLTTVRWYVLYMATHPKIQDRIFEELSVLPKDRLPCLDDLPSLPYTE
ASIAETQRIRSVVPLGIPHGCMEDIELDGYVLPKGSMVVALQWAIHMDEKHWPNPDEFNP
DRFINAEGRFFKPEAFIPFQTGKRMCVGDELARIILFLFCSSLIKTFAISAESEPDLTGE
CGITLNPKPHTLRFTLRP
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgtacattttcattgctgtcgcgataatcatcgtagcaacggcgctatggtggataaac
gaccaacacagtttgccaccaggcccttgggatttaccccttttgggtttcctcccttgg
ctggaccccgaacatccctacgaaaccctaacatcactcgctaaaaaatatgggaccatc
tacacattcaatttaggaacagtacgcacaatcgtcctgtcagatcataagattgtcaaa
caggcctttatgaaggatgcactgtctggaagggcgcctttgtacgttacacacggaata
atgaaaggacatggtttaatatgtgctgaaggagagttatggaaagaccagaggaaattc
acctcttactgtctaaaaaatttcggagtgagcaaatttggttcaaaacgcactgagctc
gagtcaatgatattaaaacatgtcgaaaatttgataaaggaaattatatcaaaaatgaat
ataaatggtacagtgacatttgatccgtttgaagatcttagacatagcgttggtacgttg
gtgtgccagcttgtatttgggagatcatgggaaaaggataacgaattatggaaatggctc
ctgtttacccaagaagaaggaactaagttagtaggtgtttcaggaccactcaacttttta
ccgtttttaagatttttgccaaaatataaaaagtcaatggattttttggtcgtaaaccag
aagaaaacacatgaaacttactccagattcatccaagaagaagaaaaagtattaaacgaa
ctgatagaatccggcaaaagtccagaaccaacaagttttgttcaagcctatttactagag
agacaaaaagacagcaaagcaaatgttaaagataaattttattctgatgttcagttgcat
cattttctcgcagatttgtttggagccgggctcgatactacattaactactgtaaggtgg
tacgtgctgtatatggcaactcaccccaaaatccaggacaggattttcgaagaattaagc
gtgttaccaaaggatcgtttgccatgtttggatgatttaccatcattaccgtacacggaa
gcttctatagcggaaactcaacgtatcagatcggttgtaccattgggcatacctcatggg
tgcatggaagatatcgaactagatgggtacgtgttgccgaaaggatcgatggttgtggct
cttcaatgggcaatccacatggacgaaaaacactggcccaatcctgacgaattcaatcct
gacagatttattaatgcagaaggacgatttttcaaacccgaagcttttataccttttcaa
actggcaaaagaatgtgtgtaggggacgaactggcaagaataatattgtttcttttctgt
tcgtcgttaataaaaacctttgcaatttccgccgaaagtgaaccagatttaactggagaa
tgcggaattaccttgaatccgaaacctcacactttaaggttcacgttgagaccttga

DBGET integrated database retrieval system