Agrilus planipennis (emerald ash borer): 108744938 Help Entry 108744938         CDS       T07419                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism apln  Agrilus planipennis (emerald ash borer) Pathway apln04137   Mitophagy - animal apln04140   Autophagy - animal apln04144   Endocytosis apln04145   Phagosome apln04148   Efferocytosis Brite KEGG Orthology (KO) [BR:apln00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108744938    04145 Phagosome     108744938    04140 Autophagy - animal     108744938    04137 Mitophagy - animal     108744938    04148 Efferocytosis     108744938  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apln04131]     108744938   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apln04147]     108744938    04031 GTP-binding proteins [BR:apln04031]     108744938 Membrane trafficking [BR:apln04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108744938 Exosome [BR:apln04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108744938   Exosomal proteins of other body fluids (saliva and urine)    108744938   Exosomal proteins of colorectal cancer cells    108744938   Exosomal proteins of bladder cancer cells    108744938 GTP-binding proteins [BR:apln04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108744938 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 cobW AAA_22 AAA_16 nSTAND3 Septin NTPase_1 AAA_7 AAA_24 PduV-EutP G-alpha ATPase_2 ABC_tran AAA_5 NACHT DAP3 AAA_14 NB-ARC Sigma54_activat Motif Other DBs NCBI-GeneID:  108744938 NCBI-ProteinID:  XP_018336417 UniProt:  A0A1W4XUF2 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MATRKKVLLKVIILGESGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLDSWRDEFLVQAAPQDPENFPF VVLGNKVDLEPRAISTKRAQQWCQSKNNIPYFETSAKEALNVEQAFQSIARNALSQQNHT VDLYSELPEPISLTKTAPRNNGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggctacaagaaagaaagtactgctaaaagttatcatcctgggggaatctggagttggg aaaacgtcgttgatgaatcagtatgtaaacaggaagttttctaatcaatacaaagcaact attggagcagacttccttactaaagaagttcaagtggatgaccgaattgtcaccatgcaa atatgggacacagcaggacaggagaggtttcaatcactaggagttgccttctacaggggt gcagactgttgtgtacttgtttttgatgtaactgccccaaatacattcaagtcgttggat agttggcgggatgagttcttggtccaggctgcaccccaagatcccgagaacttccccttc gttgttttgggcaataaagttgacctagaaccacgagctatttcgaccaaacgggcgcag cagtggtgtcaatcaaagaataacatcccttacttcgagacatcggccaaggaggcgtta aatgttgaacaggctttccaaagcatagctcggaatgctcttagccaacagaatcacacc gttgatctgtacagcgaattgcctgagcccattagcctgacgaagacggccccacgtaac aacggggactcctgtgcttgctag

DBGET integrated database retrieval system