Agrilus planipennis (emerald ash borer): 112906082 Help Entry 112906082         CDS       T07419                                  Name (RefSeq) drosomycin-like   KO K20670   drosomycin Organism apln  Agrilus planipennis (emerald ash borer) Pathway apln04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:apln00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     112906082  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:apln02000]     112906082 Transporters [BR:apln02000]  Other transporters   Accessory factors involved in transport [TC:8]    112906082 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gamma-thionin Toxin_3 Defensin Defensin_2 Motif Other DBs NCBI-GeneID:  112906082 NCBI-ProteinID:  XP_025835504 UniProt:  A0A1N7TCE0 LinkDB All DBs Position Unknown AA seq 66 aa AA seqDB search MKGYLIFAVLLIIAISTEIVFGDCLSGRYGGPCAVWDNEACRRVCREEGRSSGHCSPSLK CWCEGC NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgaagggttatttgatttttgccgttttactcatcatcgccatcagcaccgaaatagta tttggcgattgtctttctggaagatatggcggcccatgcgctgtttgggacaacgaagct tgccgcagagtatgccgggaagaaggacgctctagcggccattgcagtccaagtcttaaa tgttggtgtgagggttgctaa

DBGET integrated database retrieval system