Pseudarthrobacter phenanthrenivorans: Asphe3_20550 Help Entry Asphe3_20550      CDS       T01435                                  Name (GenBank) Glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism apn  Pseudarthrobacter phenanthrenivorans Brite KEGG Orthology (KO) [BR:apn00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Asphe3_20550 Enzymes [BR:apn01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Asphe3_20550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_2 Glrx-like GST_N_3 Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  ADX73210 UniProt:  F0M2K0 LinkDB All DBs Position 2209484..2209741 Genome browser AA seq 85 aa AA seqDB search MDFTPESGSITMFSTTWCGYCNRLKKQLDAQGIGYTEINIEEVEGTAELVEQLNGGNRTV PTVLFPDGTAATNPSAAEVKTRLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggacttcactcccgaatccggcagcatcacgatgttttccaccacctggtgcggttac tgcaaccggctgaagaagcagttggatgcgcagggcatcggttacaccgagatcaacatc gaggaagtggaaggaacggccgaactcgtggagcagctcaatggcggcaaccgcactgtg cccacggtccttttcccggacggcacagcggccaccaacccgtcagcagcagaagtcaag acgcgcctcgcagcctag

DBGET integrated database retrieval system