Pseudarthrobacter phenanthrenivorans: Asphe3_23360 Help Entry Asphe3_23360      CDS       T01435                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apn  Pseudarthrobacter phenanthrenivorans Pathway apn01100   Metabolic pathways apn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Asphe3_23360    00074 Mycolic acid biosynthesis     Asphe3_23360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Asphe3_23360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ag332 Motif Other DBs NCBI-ProteinID:  ADX73471 UniProt:  F0M507 LinkDB All DBs Position 2479820..2480065 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLAPEAVELDKSFTEDLDIDSISMMTIVVNAEEKFGVRIPD EEVKNLKTVGDAVSFIAGAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagagatcctggccggcttggctgaaatcgtcaacgaagaaacgggt ctcgctcccgaggccgtcgagctggacaagtccttcaccgaggacctggatatcgactcc atctccatgatgaccatcgtggtcaacgccgaagagaagttcggcgtccgtatcccggac gaagaggtcaagaacctcaagactgtcggcgacgccgtcagcttcatcgccggagcgcag gcctag

DBGET integrated database retrieval system