KEGG   Archaeoglobus profundus: Arcpr_0171
Entry
Arcpr_0171        CDS       T01152                                 
Name
(GenBank) acetolactate synthase, large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
apo  Archaeoglobus profundus
Pathway
apo00290  Valine, leucine and isoleucine biosynthesis
apo00650  Butanoate metabolism
apo00660  C5-Branched dibasic acid metabolism
apo00770  Pantothenate and CoA biosynthesis
apo01100  Metabolic pathways
apo01110  Biosynthesis of secondary metabolites
apo01210  2-Oxocarboxylic acid metabolism
apo01230  Biosynthesis of amino acids
Module
apo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:apo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Arcpr_0171
   00660 C5-Branched dibasic acid metabolism
    Arcpr_0171
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Arcpr_0171
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Arcpr_0171
Enzymes [BR:apo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Arcpr_0171
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_M TPP_enzyme_N POR_N
Other DBs
NCBI-ProteinID: ADB57242
UniProt: D2RG17
LinkDB
Position
146301..147959
AA seq 552 aa
MRVADAIVKALEKEGVEVAFGIPGGAIMEVYDALYDSNITHILARHEQGAVHMADGYARA
SGRVGVAFATSGPGATNTVTGIATAYMDSSPLIVFTGQVPRAMIGNDAFQEADITGITMP
ITKHNYLVTDEKEVLKIVKEAFYIASTGRPGPVLIDLPKDVTQADIDFDYPEKIEIRGYK
PKIHGHPNQIKRAVELIMKSERPIILAGGGVRISNAHPEVLELAEKIPAFVVTTLMGKGA
IPEEHPLSLGFIGMHGTKYGNLAVMDADLIIAVGCRFSDRTVGKFDEFAPNAKIIHIDID
PAEIGKNVRVDVPIVGDAKHVLREIIKFIEFKARKEWFDYVNELRRKYPLKYEYREDVIK
PQFVIEKVYELFPDAIVTTEVGQNQMWAAQYFKVKYPRQFITSGGLGTMGFGFPAAIGAK
VAFPDKVVIDIAGDGSFLMNIQELATAVDYGINVIVCVLNNAYLGMVRQWQELFYNKRYS
ATRLRYPELSFEKIAKGFGAHGITVEKPSEVEDALKEARDVDKPVVIDFHVEVEENVFPF
VPPGKSLREVLG
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgagggttgctgatgcgatcgtcaaagccttggagaaggagggtgtcgaagtagctttt
ggcatacccggtggagcgataatggaagtctacgatgctctatacgattcgaacataacc
cacatactcgcaaggcacgagcaaggagcagttcatatggctgatggatacgcaagagct
agcggcagggtcggagtcgcatttgcaacatctggccccggtgccacgaacacggttaca
ggaattgcgacagcctacatggattcctcccctctcatagtcttcacgggacaagttcca
agagcgatgatcggtaatgatgcgtttcaggaagcggatataacgggcataaccatgcca
ataacaaaacacaactacctcgttacggatgagaaggaggttttgaagattgttaaggag
gctttctatatagcctcaacaggaaggccgggtccagtcctaattgatctgccgaaggac
gttactcaggctgacatagacttcgattaccctgagaagatcgagataaggggatacaaa
cccaaaatacatggacatcccaaccagattaaaagagctgtagagcttataatgaagtct
gagagaccgataatattagcgggaggcggagttagaatatcaaacgctcatcctgaagtc
ctagagctggctgagaagatccctgcatttgttgtaactaccttaatgggtaaaggtgct
attccggaggaacatccacttagcttgggattcataggaatgcacgggacaaagtatgga
aacttggctgtaatggatgccgacttgataatagctgtcggatgcaggttcagtgataga
acggttggaaagtttgatgaatttgctccaaatgcaaaaataatccacatagatatagat
cctgcggaaataggtaagaacgtaagagtagatgtaccaatagtgggagatgctaagcat
gttttgagagagattatcaagttcatcgagtttaaggcgaggaaggagtggttcgattac
gttaacgagctaaggaggaagtatccattgaaatatgagtatcgagaggacgtgataaaa
ccacaatttgtgatagagaaagtatacgagcttttcccagacgcaatagtgactactgaa
gtcggacagaaccagatgtgggctgcacagtacttcaaagttaagtatcctagacagttc
ataacttccggtggactgggaacgatgggattcggattcccggctgcaataggtgcaaag
gttgcgtttccagataaagtcgtgatagacatagctggagacggtagtttcctgatgaac
attcaagagcttgctacagccgtcgattacggtatcaacgtcatagtttgcgttttgaac
aatgcgtaccttggaatggtcagacagtggcaagaactattctacaataaacgctattct
gccacaaggctcagatatcctgaactcagctttgagaagattgccaaagggtttggggct
cacggaataaccgttgagaaaccgagtgaggttgaggatgcacttaaagaagcaagggat
gttgataagcccgttgtgattgacttccacgttgaagtggaagagaacgtcttcccgttc
gttccaccgggcaaatcgcttagggaggtgttgggatga

DBGET integrated database retrieval system