Archaeoglobus profundus: Arcpr_0605 Help Entry Arcpr_0605        CDS       T01152                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism apo  Archaeoglobus profundus Pathway apo03010   Ribosome Brite KEGG Orthology (KO) [BR:apo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Arcpr_0605   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Arcpr_0605  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:apo03011]     Arcpr_0605    04121 Ubiquitin system [BR:apo04121]     Arcpr_0605   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apo04147]     Arcpr_0605 Ribosome [BR:apo03011]  Ribosomal proteins   Eukaryotes    Small subunit     Arcpr_0605   Archaea     Arcpr_0605 Ubiquitin system [BR:apo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Arcpr_0605 Exosome [BR:apo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Arcpr_0605   Exosomal proteins of colorectal cancer cells    Arcpr_0605 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_Ribbon_1 Ribosomal_L37e Lar_restr_allev Zn_ribbon_RPB9 Zn_ribbon_Nudix Zn_ribbon_NrdR MqsA_antitoxin Zn_ribbon_NUD DZR GFA DZR_2 DUF1451 IBR_1 Zn_ribbon_IS1595 Rpr2 Zn_ribbon_11 Zn_ribbon_NOB1 zf-C2H2_FBX41 Cas12f1-like_TNB Motif Other DBs NCBI-ProteinID:  ADB57670 UniProt:  D2RH95 LinkDB All DBs Position 513947..514111 Genome browser AA seq 54 aa AA seqDB search MAKGAECVSKYYEIKGDKVIRKRKFCPRCGEGVFLAEHKDRRTCGKCGYTEFKK NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atggctaagggcgcggaatgtgtttcgaagtattatgagataaagggtgataaggtcata agaaagaggaagttctgtccgagatgcggagaaggtgtattcttggcagaacataaggac agaaggacatgcggaaagtgtggttacactgagtttaagaagtga

DBGET integrated database retrieval system