Arthrobacter polaris: J0916_07800 Help Entry J0916_07800       CDS       T08694                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism apoa  Arthrobacter polaris Brite KEGG Orthology (KO) [BR:apoa00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     J0916_07800 Enzymes [BR:apoa01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      J0916_07800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  UIK90178 LinkDB All DBs Position 1894824..1895048 Genome browser AA seq 74 aa AA seqDB search MFSTTWCGYCKRLKKQLDAKGIRYTEINIEDVPGTAELVESLNGGNQTVPTVLFPDGSAA TXPSLNDIVAKLAA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgttttccaccacgtggtgtggctactgcaagcgcttgaagaagcagctggatgctaaa ggaatccgatacacagagatcaacatcgaagacgtccccggcactgccgagctggttgaa agcctcaatggcggtaaccaaactgttcccaccgtgttgttcccggatggctcagcagcg actaanccctcactgaatgacatcgtggccaaactcgccgcctaa

DBGET integrated database retrieval system