Arcobacter porcinus: APORC_0302 Help Entry APORC_0302        CDS       T06395                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apoc  Arcobacter porcinus Pathway apoc01100   Metabolic pathways apoc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apoc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     APORC_0302 (acpP)    00074 Mycolic acid biosynthesis     APORC_0302 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     APORC_0302 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QEP39933 UniProt:  A0A1C0B121 LinkDB All DBs Position complement(272497..272727) Genome browser AA seq 76 aa AA seqDB search MALFDDVKAVVVDQLDCDPAEVKEDSKFIEDLGADSLDVVELVMALEEKFDIEIPDEEAE KILTVGDAISYIENNA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattatttgatgatgtaaaagcagtagttgtagatcaactagattgtgatccagca gaagtaaaagaggattcaaaatttattgaagatttaggagctgactctctagatgttgtt gagttagttatggctttagaagagaaattcgatatcgaaattccagatgaagaagctgaa aaaatcttaactgttggtgatgctatatcatacattgaaaacaacgcataa

DBGET integrated database retrieval system