Ancylobacter polymorphus: K9D25_00465 Help Entry K9D25_00465       CDS       T08152                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apol  Ancylobacter polymorphus Pathway apol01100   Metabolic pathways apol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K9D25_00465    00074 Mycolic acid biosynthesis     K9D25_00465   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K9D25_00465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  UOK71234 UniProt:  A0A9E6ZT43 LinkDB All DBs Position 108464..108733 Genome browser AA seq 89 aa AA seqDB search MQTDDPAVAEIVAFISGEVGVDASLLTPDTPVAELGISSLDLIETIFKLESRFGIEIPND GPLSGSEVTVGTLVDHVAELLAAQKAKTA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcagacagacgatcccgccgtcgccgaaatcgtcgccttcatctccggcgaggtcggc gtggatgcgagcctgctcacgccggacacgccggtggcggagctgggcatctcctcgctc gacctgatcgagacgatcttcaagctggaaagccgtttcggtatcgagattcccaatgac ggcccgctgagcggcagcgaggtcacggtcggcacgctggtcgaccatgtcgccgagctg ctggcggcgcagaaggcgaagaccgcctga

DBGET integrated database retrieval system