Ancylobacter polymorphus: K9D25_18820 Help Entry K9D25_18820       CDS       T08152                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apol  Ancylobacter polymorphus Pathway apol01100   Metabolic pathways apol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K9D25_18820    00074 Mycolic acid biosynthesis     K9D25_18820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K9D25_18820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  UOK70746 UniProt:  A0A9E7D6H9 LinkDB All DBs Position complement(3938479..3938715) Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVAEHLGVEPEKVTENASFIDDLGADSLDTVELVMAFEEAFNCEIPDDAA ETILTVGDAISFLEKNAA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatattgccgagcgcgtgaagaagattgtagccgagcatctgggcgtcgagccc gagaaggttaccgagaatgcgagcttcatcgacgacctcggcgctgacagcctcgacacc gtcgagctggtcatggcctttgaagaagccttcaactgcgaaattcccgacgacgccgcc gagacgatcctgaccgtcggtgacgcgatcagcttcctggaaaagaacgcggcctga

DBGET integrated database retrieval system