Acetobacter pomorum: CPF11_12240 Help Entry CPF11_12240       CDS       T05180                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apom  Acetobacter pomorum Pathway apom01100   Metabolic pathways apom01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apom00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CPF11_12240    00074 Mycolic acid biosynthesis     CPF11_12240   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CPF11_12240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ATI13133 LinkDB All DBs Position complement(2597420..2597671) Genome browser AA seq 83 aa AA seqDB search MSETVESVSALIIQKLLANPKVPRDIDGNCKIMEDLAFDSLAVMNFVMEVEDSLDVSIPL DKLADIRTINDLAACIVALKNKG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgttgaaagcgtttccgcgctgatcattcaaaagctcctcgctaacccg aaggttccgcgtgacattgatggtaactgcaagatcatggaagatcttgcgtttgattct ttggccgtcatgaacttcgttatggaagttgaagatagcttggatgtttccatcccgctc gacaaacttgccgatatccggacgattaatgaccttgccgcatgcattgtcgctctgaaa aacaaagggtga

DBGET integrated database retrieval system