Algimonas porphyrae: AB6B39_12100 Help Entry AB6B39_12100      CDS       T10736                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apop  Algimonas porphyrae Pathway apop01100   Metabolic pathways apop01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apop00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB6B39_12100    00074 Mycolic acid biosynthesis     AB6B39_12100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB6B39_12100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  XER22852 LinkDB All DBs Position complement(2477780..2478016) Genome browser AA seq 78 aa AA seqDB search MSDVMARVKKMVVEHLDVEEEKVTENAHFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKFISEKVG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgacgtaatggctcgcgtgaaaaagatggtcgttgagcatcttgacgtggaagaa gaaaaagtcacggaaaacgcgcattttatcgacgatctgggcgctgatagcctcgacaat gtcgaactggtcatggcgttcgaagaagaattcgacatcgaaattccggatgatgccgcc gagcacatccagacagtcggtgatgccgtgaaattcatctccgaaaaggtcggctaa

DBGET integrated database retrieval system