Actinobacillus porcitonsillarum: DDU33_01845 Help Entry DDU33_01845       CDS       T05443                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apor  Actinobacillus porcitonsillarum Pathway apor01100   Metabolic pathways apor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DDU33_01845    00074 Mycolic acid biosynthesis     DDU33_01845   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DDU33_01845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1896 DUF5783 Motif Other DBs NCBI-ProteinID:  AWI50321 UniProt:  A0A2U8FH65 LinkDB All DBs Position 363459..363692 Genome browser AA seq 77 aa AA seqDB search MSIEERVKKIIVDQLGADAAQVKPEASFIEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVTKANA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaagaacgcgtaaaaaaaattatcgttgatcaattaggtgcagacgctgca caagttaaacctgaagcttcattcatcgaagatttaggcgctgactctttagacacagtt gagttagtaatggctttagaagaagaattcgatatcgaaattccagatgaagaagctgaa aaaatcacaactgttcaatcagcgattgactacgtgacaaaagctaacgcataa

DBGET integrated database retrieval system