Actinobacillus porcitonsillarum: DDU33_02135
Help
Entry
DDU33_02135 CDS
T05443
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
apor
Actinobacillus porcitonsillarum
Pathway
apor03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
apor00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
DDU33_02135
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
apor03011
]
DDU33_02135
Ribosome [BR:
apor03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
DDU33_02135
Bacteria
DDU33_02135
Archaea
DDU33_02135
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
TM1506
Motif
Other DBs
NCBI-ProteinID:
AWI50366
UniProt:
A0A2U8FIL4
LinkDB
All DBs
Position
complement(423125..423478)
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKVARIRRATRARHLMREQGATRLVVHRTPRHIYAQVIAPNGSEVLAAASTVEKVIKE
QVKYTGNKDAAAVVGKLVAERALAKGIQAVAFDRSGFKYHGRVQALADAAREAGLQF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaagtagctcgtatccgtcgtgcaacccgtgcacgtcatttaatgagagag
caaggtgcaacacgtttagttgtgcatcgcacacctcgccatatttatgcgcaggtaatt
gcacctaatggctcagaagtactagcagcagcttcaactgttgaaaaagtaattaaagag
caagttaaatacactggtaataaagacgcagctgcagtagttggtaaattagttgcagaa
cgtgctttagctaaaggtattcaagcggttgcatttgatcgttctggtttcaaataccac
ggtcgtgtgcaagcattagcagacgctgctcgtgaagctggtctacagttctaa
DBGET
integrated database retrieval system