Actinobacillus porcitonsillarum: DDU33_08445 Help Entry DDU33_08445       CDS       T05443                                  Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism apor  Actinobacillus porcitonsillarum Brite KEGG Orthology (KO) [BR:apor00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:apor03036]     DDU33_08445 Chromosome and associated proteins [BR:apor03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     DDU33_08445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB DUF7491 Occludin_ELL GAS CALCOCO1 COG6_N Mis12 ADIP DUF3450 Muted KASH_CCD K-box Cytochrom_B562 YabA PIN_12 Cluap1 ATG14 Phage_GPO Phage_Mu_Gam APG6_N UPF0242 Spc7 DUF6674 DIMCO_N TMF_DNA_bd CDK5RAP3 DUF2203 NPV_P10 DivIC Tup_N ZYG-11_interact DUF2968 Cep57_CLD_2 FapA YlqD HALZ DUF1664 Prominin Motif Other DBs NCBI-ProteinID:  AWI51506 UniProt:  A0A2U8FLZ9 LinkDB All DBs Position 1750803..1751021 Genome browser AA seq 72 aa AA seqDB search MSLSVLDELESKIKQAVETIQLLQLEVEELKEKNAEAERAKASLNQEYEQLKAEQQSFQE RLRSLLGQIDNV NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtcattatccgttcttgatgaattagaaagcaaaattaaacaagccgttgaaacaatc caattacttcaattagaagttgaagaattaaaagaaaaaaatgctgaagcagaaagagca aaagcatcactaaatcaagaatatgagcaattaaaagcagaacaacaaagcttccaagag cgtttacgttcgcttttaggtcaaattgataacgtataa

DBGET integrated database retrieval system