Acinetobacter portensis: MZO21_03315 Help Entry MZO21_03315       CDS       T08876                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism apot  Acinetobacter portensis Pathway apot01100   Metabolic pathways apot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apot00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MZO21_03315 (acpP)    00074 Mycolic acid biosynthesis     MZO21_03315 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MZO21_03315 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  UPO23872 LinkDB All DBs Position 646150..646386 Genome browser AA seq 78 aa AA seqDB search MSDIELRVKQAVAEQLGLKAEEIKNEASFMDDLGADSLDLVELVMSFENDFDITIPDEDS NEITTVQSAIDYVSKKLG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgagcgatatcgaactacgtgttaagcaagcagttgcagaacaacttggtcttaaagca gaagagattaaaaacgaagcatctttcatggatgacttaggtgcagactctcttgatcta gtagaattagtaatgtctttcgaaaacgatttcgacatcactattccagatgaagattct aacgaaatcacaactgttcaatctgctattgactatgtttctaagaaacttggttaa

DBGET integrated database retrieval system