Abrus precatorius (Indian licorice): 113852873 Help Entry 113852873         CDS       T07330                                  Name (RefSeq) polyubiquitin 9   KO K03873   elongin-B Organism aprc  Abrus precatorius (Indian licorice) Pathway aprc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aprc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113852873  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aprc04121]     113852873    03400 DNA repair and recombination proteins [BR:aprc03400]     113852873 Ubiquitin system [BR:aprc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113852873    Cul5 complex      113852873 DNA repair and recombination proteins [BR:aprc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113852873 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD UBL_UBAC1 Ubiquitin_2 Dsc3_N FlaG DUF2604 Motif Other DBs NCBI-GeneID:  113852873 NCBI-ProteinID:  XP_027339064 UniProt:  A0A8B8K732 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MDMYIRVKRSKTTYFIRCKPSDKILDIKQKLQELVDQPANNQRLILPGTGEVLDDSRTLA DQKVENDAVVALTLRKDDNEFEEVNIVRPNDFYQARDADGGNW NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggatatgtacattcgtgttaagcgtagtaagacaacatacttcatccggtgcaagcca tctgataaaattcttgacataaagcagaagttgcaagaactcgttgatcagccagctaat aatcaacgcttaattctccctggtacaggggaagtattagatgactctaggactctggca gatcaaaaggttgaaaatgatgcagttgttgcactgaccttgagaaaagatgataatgaa tttgaggaggttaacattgtccggccaaatgatttctaccaggcacgggatgcagatggt ggcaattggtga

DBGET integrated database retrieval system