Abrus precatorius (Indian licorice): 113853037 Help Entry 113853037         CDS       T07330                                  Name (RefSeq) protein MHF1 homolog   KO K11511   centromere protein S Organism aprc  Abrus precatorius (Indian licorice) Pathway aprc03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:aprc00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     113853037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aprc03036]     113853037    03400 DNA repair and recombination proteins [BR:aprc03400]     113853037 Chromosome and associated proteins [BR:aprc03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      113853037 DNA repair and recombination proteins [BR:aprc03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      113853037 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  113853037 NCBI-ProteinID:  XP_027339280 UniProt:  A0A8B8K694 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MEGLDGSSEVENDSEMKLLRDRFRLSAISIAESQAKQNGIEVSKVVVSCVADLAFKYAER VAKDVQLFAQHANRKSVNMEDVILCGHRNEHLSGLLRTFSNDLKTKDPQYERKRKKDAKK NDKTTI NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggaaggtttggatgggagcagcgaagtggaaaatgattcggaaatgaagctcttgaga gatagattcaggctctccgctatctcaatcgccgaatctcaagcaaaacaaaacggcatc gaagtttcaaaagtcgtagtctcatgcgtcgctgatttggccttcaaatatgcggagcga gtggctaaggatgttcagctctttgcgcagcatgcgaatcgtaaatctgtaaatatggaa gatgtcatactctgtggtcatcgaaatgaacatctctctggcttgttgaggaccttctct aatgatttaaagaccaaagatcctcaatatgagaggaagcgaaagaaagacgccaaaaag aatgacaaaacaaccatttag

DBGET integrated database retrieval system