Abrus precatorius (Indian licorice): 113856094 Help Entry 113856094         CDS       T07330                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism aprc  Abrus precatorius (Indian licorice) Pathway aprc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aprc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113856094  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aprc04121]     113856094    03400 DNA repair and recombination proteins [BR:aprc03400]     113856094 Ubiquitin system [BR:aprc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113856094    Cul5 complex      113856094 DNA repair and recombination proteins [BR:aprc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113856094 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  113856094 NCBI-ProteinID:  XP_027343565 UniProt:  A0A8B8KIC1 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MKKEDTVKLISAEGFEFVVDKEAAMVSQTIHNMLTSPGSFAERQHGEVTFPEISTTILEK ICQYFYWHLQFASGKETEFDIEPELTLELMMAANYLHT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaagaaggaagacacagtgaagctgatcagtgccgagggtttcgaatttgtggttgat aaagaagctgcaatggtttcacaaaccattcataacatgcttacttctccagggagtttc gctgaaaggcaacacggcgaagttacgttccctgagatcagcaccaccattctcgagaag atttgccagtacttctattggcatctccaattcgccagtgggaaggagacggaatttgat attgaacctgaattaaccctggagctaatgatggctgccaattacctccatacatga

DBGET integrated database retrieval system