Abrus precatorius (Indian licorice): 113858396 Help Entry 113858396         CDS       T07330                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism aprc  Abrus precatorius (Indian licorice) Pathway aprc03030   DNA replication aprc03082   ATP-dependent chromatin remodeling aprc03410   Base excision repair aprc03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:aprc00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     113858396    03410 Base excision repair     113858396    03420 Nucleotide excision repair     113858396   09126 Chromosome    03082 ATP-dependent chromatin remodeling     113858396  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aprc03032]     113858396    03036 Chromosome and associated proteins [BR:aprc03036]     113858396    03400 DNA repair and recombination proteins [BR:aprc03400]     113858396 Enzymes [BR:aprc01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      113858396 DNA replication proteins [BR:aprc03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     113858396 Chromosome and associated proteins [BR:aprc03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     113858396 DNA repair and recombination proteins [BR:aprc03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       113858396 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAFII28 LonB_AAA-LID Motif Other DBs NCBI-GeneID:  113858396 NCBI-ProteinID:  XP_027346846 UniProt:  A0A8B8KSH8 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MAEAEELPRAVVRRVVKEKLSRCSDDGEISVNKDALLAFSESARIFVHYLSATANDICKE SKRQIINAEDVFKALEETEFPEFVRPLKASLEEFRKKNAGKRAAVSKGKGNETTKKRKSE ADASDKGEGGDGQ NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggcggaggcggaggagcttccccgggctgtcgtgcgccgcgtggtgaaggaaaagctc tcccgttgctccgacgacggagaaatttccgtcaacaaagacgcccttctcgctttctcc gaaagcgctagaattttcgttcactacctctccgctacggctaatgacatatgtaaggag tcaaagaggcagattatcaatgctgaggatgttttcaaggctcttgaagagactgagttc cctgagtttgttcgccctctaaaagcttctctggaagagtttaggaagaagaatgctggt aaaagagctgcagtgtcgaagggaaagggaaatgagacgacaaagaaaagaaagtcggaa gctgatgcatctgataaaggtgagggtggtgacggccaatga

DBGET integrated database retrieval system