Abrus precatorius (Indian licorice): 113860633 Help Entry 113860633         CDS       T07330                                  Name (RefSeq) sm-like protein LSM6A   KO K12625   U6 snRNA-associated Sm-like protein LSm6 Organism aprc  Abrus precatorius (Indian licorice) Pathway aprc03018   RNA degradation aprc03040   Spliceosome Brite KEGG Orthology (KO) [BR:aprc00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     113860633   09123 Folding, sorting and degradation    03018 RNA degradation     113860633  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aprc03019]     113860633    03041 Spliceosome [BR:aprc03041]     113860633 Messenger RNA biogenesis [BR:aprc03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      113860633   mRNA degradation factors    5'-3' decay     Lsm complex      113860633 Spliceosome [BR:aprc03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     113860633 SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX Motif Other DBs NCBI-GeneID:  113860633 NCBI-ProteinID:  XP_027348879 UniProt:  A0A8B8L2K8 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MSGTEKGGSGTTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQTEEYVN GQLKNKYGDAFIRGNNVLYISTSKRTLAEGA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagtggaacagagaaaggaggatctggaaccaccaagacccctgctgatttcctcaaa tccattcgtgggaggccagttgttgtcaagctcaattctggtgttgattaccgaggtatc cttgcttgcctagatggctatatgaatattgcaatggaacagactgaggagtatgtcaat ggacagctgaagaacaagtatggtgatgcattcattcgagggaataacgttctatacatc agtacctcaaagaggacactagcagaaggggcatag

DBGET integrated database retrieval system