Abrus precatorius (Indian licorice): 113860930 Help Entry 113860930         CDS       T07330                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism aprc  Abrus precatorius (Indian licorice) Pathway aprc03018   RNA degradation aprc03040   Spliceosome Brite KEGG Orthology (KO) [BR:aprc00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     113860930   09123 Folding, sorting and degradation    03018 RNA degradation     113860930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aprc03019]     113860930    03041 Spliceosome [BR:aprc03041]     113860930 Messenger RNA biogenesis [BR:aprc03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      113860930   mRNA degradation factors    5'-3' decay     Lsm complex      113860930 Spliceosome [BR:aprc03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     113860930  Complex C   U2 snRNP components     113860930 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  113860930 NCBI-ProteinID:  XP_027349296 UniProt:  A0A8B8KZ84 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPEGVDIELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttctcctacttcaaggatttggtgggcagagaagtaaccgtggagctcaag aacgatttagccatccgagggacactgcattctgttgaccagtatctcaacatcaagctc gaaaacactcgcgttgtcgatcaagacaagtaccctcacatgctttctgtaaggaactgc ttcatcagagggtcggtagttagatacgtgcaattgcctcctgaaggggtggacattgaa ctattgcatgatgccacaaggagagaagctcggggtggttag

DBGET integrated database retrieval system