Abrus precatorius (Indian licorice): 113867030 Help Entry 113867030         CDS       T07330                                  Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism aprc  Abrus precatorius (Indian licorice) Pathway aprc04016   MAPK signaling pathway - plant aprc04070   Phosphatidylinositol signaling system aprc04075   Plant hormone signal transduction aprc04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:aprc00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     113867030    04070 Phosphatidylinositol signaling system     113867030    04075 Plant hormone signal transduction     113867030  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     113867030  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aprc01009]     113867030   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aprc04131]     113867030    03036 Chromosome and associated proteins [BR:aprc03036]     113867030   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aprc04147]     113867030 Protein phosphatases and associated proteins [BR:aprc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      113867030 Membrane trafficking [BR:aprc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     113867030 Chromosome and associated proteins [BR:aprc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      113867030 Exosome [BR:aprc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113867030 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen Dockerin_1 RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  113867030 NCBI-ProteinID:  XP_027357747 UniProt:  A0A8B8LPC7 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcaacttaccgatgaacagatctccgagttcaaagaagccttcagtttgttc gacaaggatggcgacggttgcatcacgaccaaggagcttggaactgttatgcgatcattg gggcaaaacccaactgaggcagagctccaggacatgattaacgaagtagatgctgatggg aatggtaccattgacttccccgagtttctaaacctcatggcccggaagatgaaggacact gattctgaggaggagctgaaggaggcattccgggttttcgacaaggatcagaatgggttc atttctgctgctgaactccgccatgtgatgaccaaccttggggagaagctcactgatgaa gaggttgatgagatgattcgcgaggctgatgttgatggtgatggccaaataaattacgaa gagtttgttaaggtgatgatggccaagtga

DBGET integrated database retrieval system