Abrus precatorius (Indian licorice): 113868779 Help Entry 113868779         CDS       T07330                                  Name (RefSeq) SKP1-like protein 1B isoform X1   KO K03094   S-phase kinase-associated protein 1 Organism aprc  Abrus precatorius (Indian licorice) Pathway aprc03083   Polycomb repressive complex aprc04120   Ubiquitin mediated proteolysis aprc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aprc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113868779    04120 Ubiquitin mediated proteolysis     113868779   09126 Chromosome    03083 Polycomb repressive complex     113868779  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aprc04131]     113868779    04121 Ubiquitin system [BR:aprc04121]     113868779    03036 Chromosome and associated proteins [BR:aprc03036]     113868779 Membrane trafficking [BR:aprc04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113868779 Ubiquitin system [BR:aprc04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113868779    Cul7 complex      113868779 Chromosome and associated proteins [BR:aprc03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113868779   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113868779 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Methyltransf_16 Motif Other DBs NCBI-GeneID:  113868779 NCBI-ProteinID:  XP_027360466 UniProt:  A0A8B8LVQ5 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MSSTRKITLKSSDGEPFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVDVANPEEKPSEDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEDEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgtccacgaggaagatcaccttgaagagttccgacggcgagcccttcgaggtggac gaggcggtggctttggagtcgcagacgattaagcacatgatcgaagacgattgcgccgac agtggcatccctcttcccaacgtcacgagcaagatcttggctaaggtcatcgaatactgc aagaagcacgtcgatgtcgccaatcccgaagagaaaccctccgaggatgatctcaaggct tgggacgctgatttcgtcaaagtcgaccaagccactctcttcgatctcatcctggctgca aactacttgaatatcaagagcctgctggaccttacatgccagactgtagcagacatgatc aaagggaagactccagaggaaattcgcaagacctttaacattaagaatgacttcactccc gaggaagaggatgaagttcgtcgggaaaaccaatgggcatttgaatga

DBGET integrated database retrieval system