Abrus precatorius (Indian licorice): 113870731 Help Entry 113870731         CDS       T07330                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism aprc  Abrus precatorius (Indian licorice) Pathway aprc03018   RNA degradation aprc03040   Spliceosome Brite KEGG Orthology (KO) [BR:aprc00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     113870731   09123 Folding, sorting and degradation    03018 RNA degradation     113870731  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aprc03019]     113870731    03041 Spliceosome [BR:aprc03041]     113870731 Messenger RNA biogenesis [BR:aprc03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      113870731   mRNA degradation factors    5'-3' decay     Lsm complex      113870731 Spliceosome [BR:aprc03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     113870731 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF150_C Hfq Motif Other DBs NCBI-GeneID:  113870731 NCBI-ProteinID:  XP_027362975 UniProt:  A0A8B8M364 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDPDDPLKT TDQTRSLGLIVCRGTAVMLVSPTDGTDEIANPFIQPDGA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtcgggtagaaaagaaacggttctggatttggcaaagttcgtcgacaaaggggttcaa gtcaagcttaccggtggcagacaagtgacaggaactctgaaaggatatgaccaattacta aaccttgtactggatgaagctgttgagtttctaagagatcctgatgatccactgaaaact accgatcagacgagaagtcttggcttaattgtttgtaggggaactgctgtcatgctcgtg tccccaacagacggtacagatgaaattgcaaaccctttcattcagcctgatggggcctag

DBGET integrated database retrieval system