Abrus precatorius (Indian licorice): 54634401 Help Entry 54634401          CDS       T07330                                  Symbol atpH, HJE71_pgp062 Name (RefSeq) ATP synthase CF0 C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism aprc  Abrus precatorius (Indian licorice) Pathway aprc00190   Oxidative phosphorylation aprc00195   Photosynthesis aprc01100   Metabolic pathways Module aprc_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:aprc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     54634401 (atpH)    00195 Photosynthesis     54634401 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:aprc00194]     54634401 (atpH) Photosynthesis proteins [BR:aprc00194]  Photosystem and electron transport system   F-type ATPase [OT]    54634401 (atpH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  54634401 NCBI-ProteinID:  YP_009772255 UniProt:  A0A6H0EMF3 LinkDB All DBs AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttctgccgcttccgttattgctgctgggttggccgtcgggcttgct tctattggacctggggttggtcaaggcactgctgcagggcaagctgtagaagggattgcg cgacaaccagaggcagagggaaaaatacggggtactttattgcttagtctggcttttatg gaagctttaacaatttatggattggttgtagcattagcgcttttatttgcgaatcctttt gtttaa

DBGET integrated database retrieval system