Ahaetulla prasina (Asian vine snake): 131184917 Help Entry 131184917         CDS       T09329                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri04010   MAPK signaling pathway apri04012   ErbB signaling pathway apri04068   FoxO signaling pathway apri04137   Mitophagy - animal apri04140   Autophagy - animal apri04144   Endocytosis apri04150   mTOR signaling pathway apri04210   Apoptosis apri04218   Cellular senescence apri04370   VEGF signaling pathway apri04371   Apelin signaling pathway apri04510   Focal adhesion apri04540   Gap junction apri04625   C-type lectin receptor signaling pathway apri04810   Regulation of actin cytoskeleton apri04910   Insulin signaling pathway apri04912   GnRH signaling pathway apri04916   Melanogenesis apri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apri00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131184917 (HRAS)    04012 ErbB signaling pathway     131184917 (HRAS)    04370 VEGF signaling pathway     131184917 (HRAS)    04371 Apelin signaling pathway     131184917 (HRAS)    04068 FoxO signaling pathway     131184917 (HRAS)    04150 mTOR signaling pathway     131184917 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     131184917 (HRAS)    04140 Autophagy - animal     131184917 (HRAS)    04137 Mitophagy - animal     131184917 (HRAS)   09143 Cell growth and death    04210 Apoptosis     131184917 (HRAS)    04218 Cellular senescence     131184917 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     131184917 (HRAS)    04540 Gap junction     131184917 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     131184917 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     131184917 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     131184917 (HRAS)    04912 GnRH signaling pathway     131184917 (HRAS)    04916 Melanogenesis     131184917 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131184917 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apri04131]     131184917 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apri04147]     131184917 (HRAS)    04031 GTP-binding proteins [BR:apri04031]     131184917 (HRAS) Membrane trafficking [BR:apri04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     131184917 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     131184917 (HRAS) Exosome [BR:apri04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    131184917 (HRAS)   Exosomal proteins of colorectal cancer cells    131184917 (HRAS) GTP-binding proteins [BR:apri04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     131184917 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 CbiA Motif Other DBs NCBI-GeneID:  131184917 NCBI-ProteinID:  XP_058012784 LinkDB All DBs Position 1:complement(260535520..260612904) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaaactggtggtggttggagcaggaggcgttgggaaaagtgcattgacc attcagctgattcagaatcattttgttgatgaatatgatcctaccatagaggattcgtac agaaagcaagtagtcatcgatggggagacctgcttactggacatcttggacactgctggc caagaggaatatagtgccatgcgagaccagtacatgaggacaggagaaggcttcctctgt gtcttcgctattaacaacaccaagtcctttgaagacattcatcagtatagagagcagatc aagagagtgaaggactccgatgatgtgcccatggtgttggtggggaataaatgtgatcta cctgctcggactgtggaaacacggcaagcccaggagctggctcggagttatgggattcca tacatagagacgtcagccaaaactagacagggagtcgaagatgccttctatactttagtg cgagagatccgacagcacaaactacgtaaattgaatcccccagatgaaagtggtccaggc tgcatgaactgcaaatgtgtaatatcatga

DBGET integrated database retrieval system