Ahaetulla prasina (Asian vine snake): 131188043 Help Entry 131188043         CDS       T09329                                  Name (RefSeq) claudin-like protein ZF-A89   KO K06087   claudin Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri03272   Virion - Hepatitis viruses apri04382   Cornified envelope formation apri04514   Cell adhesion molecule (CAM) interaction apri04530   Tight junction Brite KEGG Orthology (KO) [BR:apri00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     131188043  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     131188043  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     131188043  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     131188043  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:apri03037]     131188043    04147 Exosome [BR:apri04147]     131188043 Cilium and associated proteins [BR:apri03037]  Other cilia and associated proteins   Stereociliary proteins    131188043 Exosome [BR:apri04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    131188043   Exosomal proteins of colorectal cancer cells    131188043 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Motif Other DBs NCBI-GeneID:  131188043 NCBI-ProteinID:  XP_058018972 LinkDB All DBs Position 1:27228087..27232882 Genome browser AA seq 152 aa AA seqDB search MAALALQLVGLALSILGWLGSILACALPMWKVTAFIGSNIIVAQVFWEGLWMNCVYESTG QMQCKVYDSLLDLPADLQTTRALVVVSIAMSFLALLIAISGVRCTHFVEDPNTKAKVLRI AGSPCTEGHVIHPAHFDILKQTVPNGKEQAEI NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcagccttggccctgcagctggttgggctggcactgtctatcctgggctggctgggc tctattttggcctgcgccctacccatgtggaaggtgacggctttcatcggatctaacatc attgtggcacaggtcttctgggaggggctgtggatgaactgtgtttatgaaagcaccggt cagatgcaatgcaaggtctacgactctctacttgacctaccagcagacctacaaaccacc cgggccttggtggtggtctccatcgccatgtctttcctggctctcctgattgccatctct ggagtaaggtgcacccacttcgtagaagacccaaataccaaggccaaagttttaaggata gccgggtcaccttgcaccgaaggacatgtgatccaccctgcgcactttgatattttaaaa caaacagttccgaatggaaaagaacaagcagaaatttaa

DBGET integrated database retrieval system