Ahaetulla prasina (Asian vine snake): 131188143 Help Entry 131188143         CDS       T09329                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri04140   Autophagy - animal apri04144   Endocytosis apri04530   Tight junction Brite KEGG Orthology (KO) [BR:apri00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     131188143 (RAB8A)    04140 Autophagy - animal     131188143 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     131188143 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apri04131]     131188143 (RAB8A)    03036 Chromosome and associated proteins [BR:apri03036]     131188143 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apri04147]     131188143 (RAB8A)    04031 GTP-binding proteins [BR:apri04031]     131188143 (RAB8A) Membrane trafficking [BR:apri04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     131188143 (RAB8A)  Autophagy   Other autophagy associated proteins     131188143 (RAB8A) Chromosome and associated proteins [BR:apri03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     131188143 (RAB8A) Exosome [BR:apri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131188143 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    131188143 (RAB8A)   Exosomal proteins of colorectal cancer cells    131188143 (RAB8A) GTP-binding proteins [BR:apri04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     131188143 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin SecDF_P1_head NCH2 Motif Other DBs NCBI-GeneID:  131188143 NCBI-ProteinID:  XP_058019167 LinkDB All DBs Position 1:357962001..357983178 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCALFRFSEDAFNATFISTIGIDFKIRTIELDGKKIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIQNWVRNIEEHASPDVEKMILG NKCDITHKRQVSREQGEKLAISFGIKFMETSAKANINIDNAFFTLARDIKAKIDKKLEGN SPQGNSPGMKISPDQPKKSSFFRCALL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgactacctcttcaagctgctgctgatcggcgattccggcgtgggc aagacgtgcgcgctcttccgcttcagcgaggacgccttcaacgccactttcatctccaca atcggtattgatttcaaaatcaggacgattgaacttgatggcaagaaaataaagctgcaa atatgggacacagctgggcaagaacgattccggacaatcacaactgcttattatagagga gcaatgggcatcatgctggtgtatgatattaccaatgagaaatcttttgaaaatattcag aactgggtcagaaacattgaagagcatgcatctccagatgtagaaaaaatgatccttgga aataagtgtgatataacccacaagcggcaggtttctcgagagcaaggtgaaaagttggct attagctttggaattaaattcatggagaccagtgcaaaggcaaacattaatatagataat gcattttttacacttgccagagacatcaaagcaaaaattgacaagaaactggaaggcaat agccctcagggcaatagcccaggaatgaagatcagcccagatcagccaaagaaaagcagt tttttccgatgtgcccttctttga

DBGET integrated database retrieval system