Ahaetulla prasina (Asian vine snake): 131189108 Help Entry 131189108         CDS       T09329                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri03010   Ribosome apri04120   Ubiquitin mediated proteolysis apri04137   Mitophagy - animal apri04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:apri00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     131189108   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     131189108  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131189108    04137 Mitophagy - animal     131189108  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:apri03011]     131189108    04121 Ubiquitin system [BR:apri04121]     131189108 Ribosome [BR:apri03011]  Ribosomal proteins   Eukaryotes    Large subunit     131189108   Archaea     131189108 Ubiquitin system [BR:apri04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    131189108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD DUF2604 TBK1_ULD Ubiquitin_5 Ubiquitin_2 Motif Other DBs NCBI-GeneID:  131189108 NCBI-ProteinID:  XP_058020945 LinkDB All DBs Position 1:208410657..208410906 Genome browser AA seq 78 aa AA seqDB search MQIFVKTFTGKTITLEVEPSDTTENAKAKIQDKEGIPPDQQLLIFAGKQLEVGRTLSDYN IQKESTLHLVLHLHGGII NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcagatttttgtgaaaaccttcaccggcaaaaccatcacccttgaggtggagccgagt gacacaactgaaaatgccaaggcaaaaattcaggacaaggaaggcattcctcctgatcag cagcttctgatctttgcgggaaaacagctggaagttggacgcacactctcagactacaat atccagaaagagtccacccttcacttggtgctgcatctccatggaggaatcatttag

DBGET integrated database retrieval system