Ahaetulla prasina (Asian vine snake): 131190059 Help Entry 131190059         CDS       T09329                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri04081   Hormone signaling apri04144   Endocytosis apri04150   mTOR signaling pathway apri04270   Vascular smooth muscle contraction apri04310   Wnt signaling pathway apri04350   TGF-beta signaling pathway apri04510   Focal adhesion apri04520   Adherens junction apri04530   Tight junction apri04621   NOD-like receptor signaling pathway apri04625   C-type lectin receptor signaling pathway apri04810   Regulation of actin cytoskeleton apri05100   Bacterial invasion of epithelial cells apri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apri00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     131190059    04350 TGF-beta signaling pathway     131190059    04150 mTOR signaling pathway     131190059   09133 Signaling molecules and interaction    04081 Hormone signaling     131190059  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     131190059  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     131190059  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apri04131]     131190059   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apri04147]     131190059    04031 GTP-binding proteins [BR:apri04031]     131190059 Membrane trafficking [BR:apri04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     131190059 Exosome [BR:apri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131190059   Exosomal proteins of other body fluids (saliva and urine)    131190059   Exosomal proteins of colorectal cancer cells    131190059   Exosomal proteins of bladder cancer cells    131190059 GTP-binding proteins [BR:apri04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     131190059 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  131190059 NCBI-ProteinID:  XP_058022915 LinkDB All DBs Position 2:172705694..172719558 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ AKRGRKKTSCQLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatacgcaaaaaacttgtcattgtgggagatggagcttgtggaaagacctgc ctccttattgtcttcagcaaggaccaattcccagaagtctatgtccccactgtgtttgag aactatgtggccgacattgaagtggatggaaaacaggtagagcttgccttgtgggataca gctggacaagaagattatgaccgcctgagacccctgtcttatccagatacagatgttatc ctcatgtgcttctccattgacagccctgatagcttagagaacatccctgagaagtggact ccagaggtcaagcacttctgtcccaatgtgcctatcatcctggtaggaaacaagaaggat ttgcgtaatgatgaacatacacgtcgggagttagccaagatgaagcaggaaccagtgaag ccagaggagggcagggatatggccaacaggattagtgcttttggctacctggaatgttct gccaaaacaaaggatggagtccgggaagtgtttgagatggcaacccgagctgccctacaa gccaaacgtgggcgcaagaagacctcatgccagttgctctaa

DBGET integrated database retrieval system