Ahaetulla prasina (Asian vine snake): 131190682 Help Entry 131190682         CDS       T09329                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri04621   NOD-like receptor signaling pathway apri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apri00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     131190682  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131190682  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:apri03110]     131190682 Chaperones and folding catalysts [BR:apri03110]  Protein folding catalysts   Protein disulfide isomerase    131190682 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_9 Thioredoxin_2 Glutaredoxin OST3_OST6 AhpC-TSA Thioredoxin_7 Redoxin L27_N Motif Other DBs NCBI-GeneID:  131190682 NCBI-ProteinID:  XP_058024024 LinkDB All DBs Position 2:complement(210852669..210866355) Genome browser AA seq 100 aa AA seqDB search MEVKEFAEFLKSAGPHLVVVNFTAKWCGPCKIVRPFLHELAVRYENVLFCIVDVDSAEDV AVLCNIVVVPTFQFFMKGDKIFEVTGANKKKLEEKIEEFM NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggaagtgaaagaatttgcggaatttctgaagagtgcaggaccccaccttgttgtggtg aactttacagcaaaatggtgtgggccttgcaaaattgttcgtccttttcttcatgaattg gctgttcgatacgaaaatgtcctattctgtatcgttgatgtagactcggcagaagatgta gctgtcctctgcaatattgttgttgtgccaacatttcagttcttcatgaaaggagacaag atttttgaagtaactggggctaataaaaaaaagcttgaagagaagattgaagaatttatg taa

DBGET integrated database retrieval system