Ahaetulla prasina (Asian vine snake): 131190985 Help Entry 131190985         CDS       T09329                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri04814   Motor proteins apri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apri00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     131190985 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131190985 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:apri03037]     131190985 (DYNLT1)    04812 Cytoskeleton proteins [BR:apri04812]     131190985 (DYNLT1) Cilium and associated proteins [BR:apri03037]  Motile cilia and associated proteins   Dynein arm    131190985 (DYNLT1) Cytoskeleton proteins [BR:apri04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      131190985 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  131190985 NCBI-ProteinID:  XP_058024578 LinkDB All DBs Position 1:92717101..92723031 Genome browser AA seq 113 aa AA seqDB search MDELQSAEETAFIVDEVSNIIKEAIEGTIGGNAYLHSKVNQWTTTVVEQILSQLTKLGKP FKYVVTCVIMQKNGAGLHTANSCFWDNAADGACTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgagctccaatccgccgaggagactgcatttattgtggatgaagtaagcaacatt ataaaagaggccatagaaggaacaataggtggcaatgcatatctgcatagcaaggtgaac caatggactacaactgttgtggagcagattttaagtcaattgacaaagctggggaaacca ttcaaatatgttgtgacctgtgtgattatgcaaaaaaatggtgccggacttcacactgca aactcttgcttctgggacaatgccgctgatggagcctgcactgtaagatgggagaacaag actatgtactgtattgtcagtgcctttggacttgcaatataa

DBGET integrated database retrieval system