Ahaetulla prasina (Asian vine snake): 131191089 Help Entry 131191089         CDS       T09329                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri04810   Regulation of actin cytoskeleton apri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apri00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     131191089 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131191089 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil Motif Other DBs NCBI-GeneID:  131191089 NCBI-ProteinID:  XP_058024843 LinkDB All DBs Position 2:79650311..79651811 Genome browser AA seq 75 aa AA seqDB search MSVQEDPVQREIHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcggtgcaggaagacccggtccagcgcgagattcaccaggactgggcgaaccgcgag tacatcgaactgatcaccagctccattaagaagatcgcggacttcctcaattccttcgac atgtcctgccgctcccgcctggccacactcaatgagaagttgacggcgctggagagacgg atcgaatacatcgaggcccgggtaacaaagggtgaaacattgacatag

DBGET integrated database retrieval system