Ahaetulla prasina (Asian vine snake): 131192420 Help Entry 131192420         CDS       T09329                                  Name (RefSeq) histone H2A type 2-C-like   KO K11251   histone H2A Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri03082   ATP-dependent chromatin remodeling apri04217   Necroptosis Brite KEGG Orthology (KO) [BR:apri00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     131192420  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     131192420  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:apri03036]     131192420   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apri04147]     131192420 Chromosome and associated proteins [BR:apri03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131192420 Exosome [BR:apri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131192420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  131192420 NCBI-ProteinID:  XP_058027548 LinkDB All DBs Position 2:170154228..170154995 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKAKGK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgtggcaagcagggggggaaagctagagcgaaagccaagtctcgctcgtct cgtgctggactccagtttcccgtagggcgagtccaccgcctccttcgcaaaggaaattat gccgagcgggttggtgccggagcccccgtttaccttgctgcagtgttggaatatctgaca gccgaaattctggagctggctggcaacgctgcccgggataacaagaaaactagaattatc cctcgccacctccagttggccgtccgtaacgacgaggagctcaataagctactgggaggc gtcactattgcccagggaggcgtcttgcccaatatccaagcggtgctactgcccaagaag accgagagccacaaggccaaaggcaaatga

DBGET integrated database retrieval system