Ahaetulla prasina (Asian vine snake): 131195174 Help Entry 131195174         CDS       T09329                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri04010   MAPK signaling pathway apri04012   ErbB signaling pathway apri04068   FoxO signaling pathway apri04137   Mitophagy - animal apri04140   Autophagy - animal apri04150   mTOR signaling pathway apri04210   Apoptosis apri04218   Cellular senescence apri04370   VEGF signaling pathway apri04371   Apelin signaling pathway apri04540   Gap junction apri04625   C-type lectin receptor signaling pathway apri04810   Regulation of actin cytoskeleton apri04910   Insulin signaling pathway apri04912   GnRH signaling pathway apri04916   Melanogenesis Brite KEGG Orthology (KO) [BR:apri00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131195174 (NRAS)    04012 ErbB signaling pathway     131195174 (NRAS)    04370 VEGF signaling pathway     131195174 (NRAS)    04371 Apelin signaling pathway     131195174 (NRAS)    04068 FoxO signaling pathway     131195174 (NRAS)    04150 mTOR signaling pathway     131195174 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131195174 (NRAS)    04137 Mitophagy - animal     131195174 (NRAS)   09143 Cell growth and death    04210 Apoptosis     131195174 (NRAS)    04218 Cellular senescence     131195174 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     131195174 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     131195174 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     131195174 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     131195174 (NRAS)    04912 GnRH signaling pathway     131195174 (NRAS)    04916 Melanogenesis     131195174 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apri04131]     131195174 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apri04147]     131195174 (NRAS)    04031 GTP-binding proteins [BR:apri04031]     131195174 (NRAS) Membrane trafficking [BR:apri04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     131195174 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     131195174 (NRAS) Exosome [BR:apri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131195174 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    131195174 (NRAS)   Exosomal proteins of breast cancer cells    131195174 (NRAS)   Exosomal proteins of colorectal cancer cells    131195174 (NRAS) GTP-binding proteins [BR:apri04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     131195174 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  131195174 NCBI-ProteinID:  XP_058032860 LinkDB All DBs Position 3:complement(186776377..186787749) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSEDVPMVLVGNKCDL PTRTVDTKQAHEVAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKRLNSNEDGNQG CMGVSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtagtaggagctgggggtgttggaaaaagtgccctgacc atccagcttatccagaatcacttcgtagatgaatatgatcctactattgaggattcttac cgcaaacaagttgttattgatggagagacttgtttgctagacatcttggatacggcagga caggaggaatatagtgccatgagggaccaatatatgagaactggggaaggctttctttgt gtgtttgccattaacaacagcaaatcatttgcagatataaatctttacagagagcaaatt aaaagagtgaaagattcagaagatgtaccaatggtattagtgggaaacaaatgtgattta ccaacaagaacagtagataccaagcaggctcacgaagtagcaaagagttatggtattcca ttcattgaaacatctgccaaaacaagacagggtgttgaagatgctttttatacactggtt agagaaatccgtcagtatcgaatgaaaaggctcaacagtaatgaagatgggaatcaaggc tgcatgggggtgtcgtgtcttgtgatgtga

DBGET integrated database retrieval system