Ahaetulla prasina (Asian vine snake): 131197389 Help Entry 131197389         CDS       T09329                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri04810   Regulation of actin cytoskeleton apri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apri00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     131197389 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131197389 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apri04131]     131197389 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:apri04812]     131197389 (PFN1)    04147 Exosome [BR:apri04147]     131197389 (PFN1) Membrane trafficking [BR:apri04131]  Others   Actin-binding proteins    Others     131197389 (PFN1) Cytoskeleton proteins [BR:apri04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      131197389 (PFN1) Exosome [BR:apri04147]  Exosomal proteins   Proteins found in most exosomes    131197389 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin DUF4982 Motif Other DBs NCBI-GeneID:  131197389 NCBI-ProteinID:  XP_058037380 LinkDB All DBs Position 4:complement(369924..372719) Genome browser AA seq 140 aa AA seqDB search MSGWSCYIDSLMADNTCQDAAIVGYKDAPSVWASAPGKTFAGITPAEVNVLTGKDRSNLF VNGLTLGGQKCSVIRDNLHMDGESTMDLRTKSTGGAPTYNITAAMTNKTIVLVMGKEGIH GGCINKKCYEMANHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgagcggctggagctgctacatcgacagcctgatggccgacaacacctgccaggacgcg gccatcgtgggctacaaggacgcgccctccgtctgggcctccgccccgggcaagaccttc gccggcatcacgcccgcggaagtgaacgtgctgacggggaaggaccgcagcaacctcttc gtgaacgggctgacgctgggcgggcagaagtgctccgtcatccgggacaacctgcacatg gacggggagagcaccatggacctgcggacaaagagcaccggcggcgcccccacctacaac atcacggccgccatgaccaacaagacaatcgtgctcgtcatgggcaaggagggcatccac ggcggctgcatcaacaagaagtgttacgagatggccaaccacttgcggcggtcgcagtat tga

DBGET integrated database retrieval system