Ahaetulla prasina (Asian vine snake): 131197718 Help Entry 131197718         CDS       T09329                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri04060   Cytokine-cytokine receptor interaction apri04218   Cellular senescence apri04620   Toll-like receptor signaling pathway apri04621   NOD-like receptor signaling pathway apri04622   RIG-I-like receptor signaling pathway apri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apri00001]  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131197718  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:apri04052]     131197718    00536 Glycosaminoglycan binding proteins [BR:apri00536]     131197718 Cytokines and neuropeptides [BR:apri04052]  Cytokines   Chemokines    131197718 Glycosaminoglycan binding proteins [BR:apri00536]  Heparan sulfate / Heparin   Chemokines    131197718 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  131197718 NCBI-ProteinID:  XP_058038092 LinkDB All DBs Position 4:51941748..51944955 Genome browser AA seq 103 aa AA seqDB search MDFKTVAAFLALFLISATVTEGASLASVGLELRCQCIETYSNPSLRGHIASVNLIKSGPH CSNIQVIATLKDGRRVCLDPTAIWVKKVITNLLEKAKNNAETQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggacttcaagactgtggcggcatttttggctcttttcttgatctctgcaacagtgaca gaaggagcttcattggccagtgtagggcttgaacttcggtgtcaatgtatagaaacctat tctaatcccagcctccgtggacacattgcaagtgtcaacttgatcaaaagtgggccacat tgcagtaacattcaggtcattgcaactcttaaggatggcagacgagtgtgcttggacccc actgcaatctgggtgaaaaaagtcatcacaaatcttctggaaaaggctaagaataatgca gagacacagtga

DBGET integrated database retrieval system