Ahaetulla prasina (Asian vine snake): 131199103 Help Entry 131199103         CDS       T09329                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism apri  Ahaetulla prasina (Asian vine snake) Pathway apri04814   Motor proteins apri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apri00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     131199103 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131199103 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:apri03037]     131199103 (DYNLT3)    04812 Cytoskeleton proteins [BR:apri04812]     131199103 (DYNLT3) Cilium and associated proteins [BR:apri03037]  Motile cilia and associated proteins   Dynein arm    131199103 (DYNLT3) Cytoskeleton proteins [BR:apri04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      131199103 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Peptidase_S6 Motif Other DBs NCBI-GeneID:  131199103 NCBI-ProteinID:  XP_058040449 LinkDB All DBs Position 5:67088917..67123148 Genome browser AA seq 116 aa AA seqDB search MEECHPRNNEVIFNTEEDYNTIKDCIEGVLGKADYNHDRVNKLIATIVEQSLANLVKLGK TYKYIVTCAVMQKCGAGLHTASSCFWDTTTDGTCTVRWENRTMNCVVSIFAVAIIL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtgtcatccccgtaacaatgaggtgatctttaacactgaagaagactacaat actattaaagattgcatagaaggtgttctaggcaaagcagattataaccatgacagggtg aataaattgattgctactatagtagaacagtctctagcaaatctggtaaaactgggaaaa acatataagtatattgtgacctgtgctgtgatgcagaaatgtggggctggtctgcatact gcaagctcatgtttttgggatactacaactgatggtacttgcacagtcagatgggaaaac agaacaatgaattgtgtggtcagtatctttgctgtggccataatcttgtag

DBGET integrated database retrieval system