Auxenochlorella protothecoides: CP73_p042 Help Entry CP73_p042         CDS       T04132                                  Symbol psbI Name (RefSeq) I polypeptide of photosystem II   KO K02710   photosystem II PsbI protein Organism apro  Auxenochlorella protothecoides Pathway apro00195   Photosynthesis apro01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:apro00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     CP73_p042 (psbI)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:apro00194]     CP73_p042 (psbI) Photosynthesis proteins [BR:apro00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Other common subunits     CP73_p042 (psbI) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PsbI Anoctamin Motif Other DBs NCBI-GeneID:  18667168 NCBI-ProteinID:  YP_009019348 UniProt:  A0A023HHZ3 LinkDB All DBs Position CP AA seq 38 aa AA seqDB search MLTLKIFVYTVVTFFVSLFIFGFLSNDPGRSPGQKDID NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgttaactttaaaaatttttgtatatactgttgtaacattttttgtttcacttttcatt tttggatttttatctaatgacccgggcagaagtccagggcaaaaagatattgattaa

DBGET integrated database retrieval system