Auxenochlorella protothecoides: CP73_p046 Help Entry CP73_p046         CDS       T04132                                  Symbol atpH Name (RefSeq) CF0 subunit III of ATP synthase   KO K02110   F-type H+-transporting ATPase subunit c Organism apro  Auxenochlorella protothecoides Pathway apro00190   Oxidative phosphorylation apro00195   Photosynthesis apro01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:apro00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CP73_p046 (atpH)    00195 Photosynthesis     CP73_p046 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:apro00194]     CP73_p046 (atpH) Photosynthesis proteins [BR:apro00194]  Photosystem and electron transport system   F-type ATPase [OT]    CP73_p046 (atpH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  18667163 NCBI-ProteinID:  YP_009019344 UniProt:  A0A023HHQ2 LinkDB All DBs Position CP AA seq 82 aa AA seqDB search MDPLVAAASVVAAGLAVGLAAVGPGIGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFM ESLTIYGLVVALALLFANPFVS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggatccacttgttgctgctgctagcgttgttgctgctggtcttgctgttggtcttgct gctgttggtcctggtattggacaaggaactgctgctggttatgcagtagaaggtattgct cgccaaccagaagcagaaggtaaaattagaggtgctttacttttaagttttgcttttatg gaatcgttaacaatttatggtctggttgttgctttagctcttttatttgcaaaccctttt gtatcataa

DBGET integrated database retrieval system