Auxenochlorella protothecoides: F751_0101 Help Entry F751_0101         CDS       T04132                                  Name (RefSeq) hypothetical protein   KO K11368   enhancer of yellow 2 transcription factor Organism apro  Auxenochlorella protothecoides Brite KEGG Orthology (KO) [BR:apro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:apro03021]     F751_0101    03019 Messenger RNA biogenesis [BR:apro03019]     F751_0101    03036 Chromosome and associated proteins [BR:apro03036]     F751_0101 Transcription machinery [BR:apro03021]  Eukaryotic type   RNA polymerase II system    Coactivators     SAGA/TFTC/STAGA complex      F751_0101 Messenger RNA biogenesis [BR:apro03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      F751_0101 Chromosome and associated proteins [BR:apro03036]  Eukaryotic type   Histone modification proteins    HAT complexes     SAGA complex      F751_0101     SLIK complex      F751_0101 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EnY2 Motif Other DBs NCBI-GeneID:  23611492 NCBI-ProteinID:  XP_011399880 UniProt:  A0A087S9Q0 LinkDB All DBs AA seq 93 aa AA seqDB search MSTPIQENPSKQKGEQGCERDRLKFVARGCLEESGWVDVVQELCRAHLRTDPSFPLGSLA EAVRPAARAAVPDHVKATVLKVVRASICPTDDS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgagcaccccgattcaagagaaccccagcaagcaaaagggtgagcagggttgtgagagg gaccggttgaagttcgtggcccggggctgcctggaggagagcggctgggtcgacgtcgtc caggagctttgtcgcgcccacctgcgcaccgacccctcctttccgcttgggagcctcgcg gaggccgtgcgccctgcagcccgcgccgcggtccccgatcacgtcaaggccacggtgctg aaggtcgtgcgtgccagcatctgccccaccgacgactcctag

DBGET integrated database retrieval system