Auxenochlorella protothecoides: F751_5121 Help Entry F751_5121         CDS       T04132                                  Name (RefSeq) Autophagy-related protein 8d   KO K08341   GABA(A) receptor-associated protein Organism apro  Auxenochlorella protothecoides Pathway apro04136   Autophagy - other Brite KEGG Orthology (KO) [BR:apro00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     F751_5121  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apro04131]     F751_5121    04121 Ubiquitin system [BR:apro04121]     F751_5121    03029 Mitochondrial biogenesis [BR:apro03029]     F751_5121 Membrane trafficking [BR:apro04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     F751_5121 Ubiquitin system [BR:apro04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    F751_5121 Mitochondrial biogenesis [BR:apro03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     F751_5121 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 Motif Other DBs NCBI-GeneID:  23616512 NCBI-ProteinID:  XP_011397166 UniProt:  A0A087SEX5 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MVRTKTFKEEHPLEKRQAEATRIREKYPDRIPVIVEKAEKSDIPDIDKKKYLVPADLTVG QFVYVIRKRIKVSPEKAIFIGESTFGC NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggtccgcaccaagactttcaaggaggaacacccgctcgagaaacgccaggctgaggcc acaaggattcgcgagaagtatcccgacaggattccggtcatcgtcgagaaggcggagaag agcgacatccctgacattgacaagaagaagtacctggtgccagcagacctgaccgtgggc cagttcgtgtacgtcatccggaagcgcatcaaggtcagccccgagaaggccatcttcatc ggggagagcacctttggctgctag

DBGET integrated database retrieval system