Auxenochlorella protothecoides: F751_6908 Help Entry F751_6908         CDS       T04132                                  Name (RefSeq) Dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism apro  Auxenochlorella protothecoides Pathway apro04814   Motor proteins Brite KEGG Orthology (KO) [BR:apro00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     F751_6908  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:apro03037]     F751_6908    04812 Cytoskeleton proteins [BR:apro04812]     F751_6908 Cilium and associated proteins [BR:apro03037]  Motile cilia and associated proteins   Dynein arm    F751_6908 Cytoskeleton proteins [BR:apro04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      F751_6908 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  23618299 NCBI-ProteinID:  XP_011396818 UniProt:  A0A087SDY6 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MSDSDVLQASDIEPLIRNGIQATVHGDWNEEEALVWQEGIGTACLKLLAGLARPYKFAVT THLSQRAGAGLCSATAAHWNPNTDGHTAVIWTSDTVFVCVTVFWSAV NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgtccgacagtgacgtcctgcaggcatccgacatcgagccactgatccggaatgggata caggccaccgtccatggcgattggaacgaggaggaggccctggtctggcaggaggggatc ggtaccgcctgcctgaagctgctcgcgggcctagcccggccctacaagtttgccgtcacc acccacctcagccagcgagcgggggcggggctctgctccgccacggcagcccactggaac cccaacacagacggacacaccgctgtgatctggacctcggacaccgtctttgtttgcgtg acggtcttctggtcggctgtgtga

DBGET integrated database retrieval system