Amycolatopsis pretoriensis: MUY14_20950 Help Entry MUY14_20950       CDS       T08335                                  Name (GenBank) acyl carrier protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism aprt  Amycolatopsis pretoriensis Pathway aprt01051   Biosynthesis of ansamycins aprt01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:aprt00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     MUY14_20950    01051 Biosynthesis of ansamycins     MUY14_20950  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aprt01008]     MUY14_20950 Polyketide biosynthesis proteins [BR:aprt01008]  Polyketide tailoring proteins   Others    MUY14_20950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UOX92962 LinkDB All DBs Position complement(4910078..4910353) Genome browser AA seq 91 aa AA seqDB search MNDVSTTATPARTPEAVTREIREFLTGRVKQDVPDDQDLFRTGLVSSMFAMELVVFLEQT YGIAIVGPDLKLDNFRTVESMTALVGRLLDE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgaacgacgtctccaccaccgcaaccccggcgcgcacgccggaggccgtcacgcgggag atccgggagttcctgaccggacgcgtcaagcaggacgtcccggacgaccaggacctcttc cgcaccggcctggtctcctcgatgttcgccatggagctggtcgtgttcctcgagcagacc tacggcatcgccatcgtcgggccggacctcaagctcgacaacttccgcaccgtcgaaagc atgacggcgctcgtggggcgcctgctcgatgagtga

DBGET integrated database retrieval system