Amycolatopsis sp. FBCC-B4732: MUY14_22555 Help Entry MUY14_22555       CDS       T08335                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism aprt  Amycolatopsis sp. FBCC-B4732 Pathway aprt00253   Tetracycline biosynthesis aprt01056   Biosynthesis of type II polyketide backbone aprt01100   Metabolic pathways aprt01110   Biosynthesis of secondary metabolites Module aprt_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:aprt00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     MUY14_22555    00253 Tetracycline biosynthesis     MUY14_22555  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:aprt01004]     MUY14_22555    01008 Polyketide biosynthesis proteins [BR:aprt01008]     MUY14_22555 Lipid biosynthesis proteins [BR:aprt01004]  Polyketide synthase   Component type    MUY14_22555 Polyketide biosynthesis proteins [BR:aprt01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      MUY14_22555     Nonaketide PKS      MUY14_22555     Decaketide PKS      MUY14_22555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UOX84605 LinkDB All DBs Position complement(5265668..5265928) Genome browser AA seq 86 aa AA seqDB search MSDTGFTLDDLMRILREGSGETEEPAGDPAGVEFAELGYDSLALLETAGRIEREYGLTLD ESALAEATTPRALVELVNEHLARVRA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtccgacacgggattcaccctcgacgacctgatgcggatcctgcgcgagggctcgggg gagaccgaagaaccggccggcgatcccgccggcgtcgagttcgccgaactgggctacgac tcgctggcgctgctggaaaccgccggccggatcgagcgcgagtacggcctgaccctcgac gaatccgcactggcggaggccacgacgccgcgggcgctggtcgagctggtgaacgagcac ctggcccgggtccgcgcctga

DBGET integrated database retrieval system